Description
FOXO4-DRI is a synthetic retro-inverso peptide, meaning it is assembled from D-amino acids in reversed sequence order relative to the native segment it is based on. The D-configuration confers resistance to proteolytic degradation. The molecule combines a sequence derived from the FOXO4 forkhead domain with a polycationic cell-penetrating carrier sequence.
In published in vitro literature, FOXO4-DRI has been characterized as an interfering peptide that competes with the FOXO4 protein for binding to p53. This material is supplied as a characterized reference compound for non-clinical laboratory work, such as analytical method development for D-peptides, protein-protein interaction and competitive binding assays, cell-penetrating peptide uptake studies, and comparative proteolytic stability studies.
Peptide Information
- Peptide Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (all D-amino acids, retro-inverso)
- Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄
- Molecular Weight: ~5358 g/mol
- CAS Number: 2460055-10-9
Storage & Handling
Store at −20 °C, protected from light. Avoid moisture and handle in accordance with standard laboratory safety practices.
Research-Use Notice
For non-clinical in vitro laboratory research and analytical use only. Not intended for human or veterinary use, ingestion, injection, administration, compounding, clinical use, or diagnostic procedures. Not intended for use in any drug, food, cosmetic, or dietary-supplement product. No representation is made regarding suitability for any clinical or therapeutic application.