🚚 FREE U.S. Shipping on Orders Over $500
🛒 0
SKU: UB-TESA-IPA_10/5_BLEND

UB-TESA / IPAMORELIN Blend (10/5mg)

This blend contains two synthetic peptides in a single lyophilized preparation: UB-Tesa, a 44-residue growth hormone-releasing hormone analogue, and ipamorelin, a synthetic pentapeptide ligand of the growth hormone secretagogue receptor (GHS-R1a).

It is supplied as a characterized reference material for non-clinical laboratory work, such as analytical method development for multi-peptide preparations, receptor binding assays, and comparative in vitro studies of GHRH receptor and GHS-R1a ligands.

Chemical & Formula Details

UB-Tesa

  • Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂
  • Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S
  • Molecular Weight: ~5195.9 g/mol
  • PubChem CID: 44147413
  • CAS Number: 901758-09-6

Ipamorelin

  • Sequence: Aib-His-D-2Nal-D-Phe-Lys-NH₂
  • Molecular Formula: C₃₈H₄₉N₉O₅
  • Molecular Weight: ~711.9 g/mol
  • PubChem CID: 9831659
  • CAS Number: 170851-70-4

 

Storage & Handling
Store at −20 °C, protected from light. Avoid moisture and repeated freeze-thaw cycles. Handle in accordance with standard laboratory safety practices.

FOR RESEARCH USE ONLY. Not for human consumption. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.

Price range: $110.00 through $150.00

Choose Quantity
Tesa/ Ipamorelin blend
Batch Documentation
COA / Lab Reports
1 report

Description

This blend contains two synthetic peptides in a single lyophilized preparation: UB-Tesa, a 44-residue growth hormone-releasing hormone analogue, and ipamorelin, a synthetic pentapeptide ligand of the growth hormone secretagogue receptor (GHS-R1a).

It is supplied as a characterized reference material for non-clinical laboratory work, such as analytical method development for multi-peptide preparations, receptor binding assays, and comparative in vitro studies of GHRH receptor and GHS-R1a ligands.

Chemical & Formula Details

UB-Tesa

  • Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂
  • Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S
  • Molecular Weight: ~5195.9 g/mol
  • PubChem CID: 44147413
  • CAS Number: 901758-09-6

Ipamorelin

  • Sequence: Aib-His-D-2Nal-D-Phe-Lys-NH₂
  • Molecular Formula: C₃₈H₄₉N₉O₅
  • Molecular Weight: ~711.9 g/mol
  • PubChem CID: 9831659
  • CAS Number: 170851-70-4

 

Storage & Handling
Store at −20 °C, protected from light. Avoid moisture and repeated freeze-thaw cycles. Handle in accordance with standard laboratory safety practices.

FOR RESEARCH USE ONLY. Not for human consumption. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.

Additional information

Weight 0.1 lbs
Dimensions 1 × 1 × 2 in
Size

10mg/5mg, 12mg/3mg

Scientific Reviewer

Scientifically reviewed by Dr. Julian H. Park, MD. Dr. Park serves as Scientific Reviewer for Universal BioLabs, helping uphold the accuracy, credibility, and scientific rigor of all technical content and research citations. He earned his medical degree from the University of California, Irvine School of Medicine and completed residency training in family medicine at Cedars-Sinai Medical Center. With more than 20 years of clinical experience, Dr. Park reviews research citations, study interpretations, and technical content for scientific accuracy.

Disclaimer: For Research Purposes Only

This content is supplied exclusively for research and educational purposes. Nothing presented here should be interpreted as approval, promotion, or encouragement of any non-laboratory use, improper handling, or non-research application of peptides intended for scientific investigation. Any references to specific peptides, their properties, or findings associated with them are provided solely as informational research content. They are not medical advice, legal advice, clinical guidance, or a recommendation for personal, therapeutic, or non-research use. These compounds are intended only for controlled scientific work conducted by qualified and authorized individuals. Before making any decision regarding the purchase, possession, handling, or use of research peptides, appropriate consultation with qualified research professionals, medical experts, or legal counsel is strongly advised. All information should be used responsibly, ethically, and only in connection with legitimate academic, scientific, or investigative purposes. This notice applies broadly to all peptide-related content provided here and may be updated as needed.

0